PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_24271g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 513aa    MW: 56875.1 Da    PI: 6.3607
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_24271g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.3e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++++G g+W+t +++ g+ R++k+c++rw +yl
    MA_24271g0020 14 KGPWTPEEDQKLTDYIQRHGHGSWRTLPKHAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding521.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ +v+++  lG++ W++Ia++++ gRt++++k++w+++l
    MA_24271g0020  67 RGKFSFEEEQTIVQLHGVLGNK-WSAIASHLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129416.962961IPR017930Myb domain
SuperFamilySSF466897.34E-3111108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
CDDcd001671.07E-111661No hitNo description
PROSITE profilePS5129425.42862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2665116IPR009057Homeodomain-like
SMARTSM007172.8E-1666114IPR001005SANT/Myb domain
PfamPF002493.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.16E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MGRAPCCDKD GLKKGPWTPE EDQKLTDYIQ RHGHGSWRTL PKHAGLLRCG KSCRLRWTNY  60
LRPDIKRGKF SFEEEQTIVQ LHGVLGNKWS AIASHLPGRT DNEIKNYWNT HLKKRLLQMG  120
IDPVTHRPRI DLFNFSNMTQ LLAPASLSHM AAQWERARLE AVTTDYLRVL AAYRSAAMMQ  180
QASHSQSSTM DADHLMSYLR NQLGDAAFCN MPDNMNSAMA QANWALNSEN LGSSDSNALA  240
TQIIMEQLQV PAAQIMRNLQ SQTQNTAELS ACSLPLNGTS MTQHSSPTST LSSLDGFHTL  300
KAEQRNNNSN KNNVPNSHES TKINNQALLQ DQGYDNLMNA SASLVQQHSR SQDNNSLSTD  360
QLVTSPILWP EEQFLGISKN NNSESVPALV STTSSPNIFN DTSDMFHDAS PVQNSQNCMR  420
SDCISTNGYG LPADLFLDFG LETTKQQNVE TMAPATSTTH VLSGSSSWSE MQNSLLSGSS  480
SWSEMQNSHE DGGDYWSNML KYVGESSISN STL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6010740.0EF601074.1 Picea glauca R2R3-MYB transcription factor MYB11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYF50.0A5JYF5_PICGL; R2R3-MYB transcription factor MYB11
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.15e-85myb domain protein 93